PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100199140061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 325aa    MW: 36819.9 Da    PI: 10.1638
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100199140061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.47.9e-11253303353
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                                    R +++k q+e+Le+++++++ p+ +++  + + ++L+ ++V  WF  +Ra
  Ote100199140061|100199140061 253 ARKRLKKAQVETLEQVYRRSKRPTNAMISSIVHLTNLPRKRVVKWFEDKRA 303
                                   58999*********************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.738248308IPR001356Homeobox domain
SuperFamilySSF466895.56E-11249315IPR009057Homeodomain-like
SMARTSM003892.3E-7250312IPR001356Homeobox domain
CDDcd000861.47E-8251303No hitNo description
Gene3DG3DSA:1.10.10.601.8E-9253307IPR009057Homeodomain-like
PfamPF000462.1E-8253303IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MMRTKKVRAA YLGRLLHFPF GADVFAIGDR LMKLRFGLCP KMEPPLRFAG LRCFSRRRDV  60
ANSPSTPKKI GKKKVAKKEE EGEDIGEDAF EALFRQLEED LKNDGLLXXX XXXXXXXXXL  120
AKLEQELAEA LEDDDLLVAL GSAALGEEMP VKLKNWQLRR LAYALKDGRR KTSIKNLAAD  180
LCLDRAIVLK LLRDPPPNLV MLSATLPDKP ATKVLAPVEK VEEDVPLETT TNAVKPEVEV  240
KVPVHVMQSN WSARKRLKKA QVETLEQVYR RSKRPTNAMI SSIVHLTNLP RKRVVKWFED  300
KRAEDGVPEQ RVPYEPRASE SVPTS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069587.11e-130PREDICTED: DNA ligase 1
TrEMBLA0A068V0R61e-103A0A068V0R6_COFCA; Uncharacterized protein
STRINGVIT_04s0008g05190.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94282327